If you have been reading about somatotroph and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-05-05. Where a claim depends on a specific study, the study is described rather than over-claimed.
CJC-1295 acts at the growth hormone-releasing hormone receptor, a G-protein-coupled receptor found on somatotroph cells in the anterior pituitary. Binding triggers a rise in cyclic AMP and calcium entry, which promotes release of stored growth hormone. Because the peptide mimics the body's own releasing hormone, it amplifies existing secretory pulses rather than driving continuous output. The size of the response therefore depends partly on the subject's own hormonal rhythm and feedback state.
The attached maleimide group explains the unusual duration of the DAC version. After injection it reacts with the thiol of cysteine-34 on serum albumin, forming a stable covalent bond. The resulting conjugate is too large for rapid kidney filtration and is shielded from many peptidases. Reported half-lives for this form reach several days, whereas the version without the group is cleared in roughly half an hour. That gap is the main pharmacological difference between the two.
Downstream of growth hormone, the liver and other tissues increase production of insulin-like growth factor 1, a mediator of many growth-promoting effects. Studies have documented elevated levels of both hormones after dosing, and the rise from the long-acting form persists longer than that produced by shorter-acting analogues. What remains unclear is whether sustained elevation of these markers translates into meaningful clinical benefit, and whether prolonged exposure carries risks that short trials could not detect.
Lyophilized peptide powder is comparatively stable when kept dry, cold, and protected from light. Once dissolved, the molecule is vulnerable to deamidation, oxidation, and aggregation, with the rate depending on pH, buffer composition, and temperature. Alkaline conditions and repeated freeze-thaw cycles accelerate loss of the intact peptide. The methionine present in the native sequence is a known oxidation site, which is one reason it was replaced in the modified fragment. Suppliers typically recommend cold storage of solutions and use within a short window.
Analytical confirmation usually relies on reversed-phase high-performance liquid chromatography for purity and on liquid chromatography coupled to mass spectrometry for identity. Mass data reveal the expected molecular mass and can flag truncated or oxidized species. Amino acid analysis and peptide mapping provide sequence-level verification. Immunoassays are used in some biological matrices, but antibodies raised against one releasing-hormone analog may cross-react with another. Reported purity figures depend heavily on the method used, so comparisons between suppliers require matching the analytical approach.
| Property | Value | Notes |
|---|---|---|
| Primary target | GHRH receptor | G-protein-coupled receptor on pituitary somatotrophs |
| Half-life, long-acting form | Several days | Extended by covalent albumin binding |
| Half-life, short form | About 30 minutes | Cleared rapidly by peptidases and kidneys |
| Route in studies | Subcutaneous injection | Used in the published human trials |
| Main measured effect | Rise in GH and IGF-1 | Surrogate markers rather than clinical endpoints |
Reported half-lives differ widely between the two variants and between species. Values for the albumin-binding form are usually expressed in days, while the unconjugated form is measured in minutes to a few hours. Sampling schedules, assay sensitivity, and route of administration all influence the numbers, which limits direct comparison across studies. Whether sustained receptor occupancy produces different downstream effects from pulsatile stimulation remains an open question in the published work. Claims about relative potency should therefore be read alongside the specific study design that produced them.
Lyophilised powder is the usual supplied form. The material is hygroscopic, so vials are typically equilibrated to room temperature before opening in order to prevent condensation on the contents. Long-term storage is generally described at minus twenty degrees Celsius or colder, protected from light and moisture. Repeated freeze-thaw cycles are avoided because they promote aggregation and loss of soluble material. A reconstituted solution is considerably less stable than the dry powder and is normally kept refrigerated for short periods only.
Identity and purity are assessed mainly by reversed-phase high-performance liquid chromatography combined with mass spectrometry. The chromatographic separation resolves the target peptide from truncation products and from species carrying oxidised residues, while mass measurement confirms the expected molecular mass. Because the two common variants differ by roughly 280 daltons, a mass determination distinguishes them unambiguously. Purity is often quoted as a percentage of total peak area, although that figure depends on the detection wavelength and the integration method applied.
Lyophilized material is generally stable for extended periods when held at minus twenty degrees Celsius or below and protected from moisture and light. In solution the peptide is more labile; bond hydrolysis, aggregation and oxidation of susceptible residues all proceed faster at ambient temperature. Repeated freeze and thaw cycles should be avoided because they promote clumping and loss of soluble material. The conjugated variant adds a further consideration, since the maleimide group can hydrolyze in aqueous buffer and lose its ability to react with albumin.
Laboratory handling centers on minimizing exposure to water, heat and oxygen before use. Working solutions are typically prepared in sterile water or a mild buffer, and any residual particulate matter is removed by filtration. When the powder dissolves slowly, a small proportion of acetonitrile or dilute acetic acid is sometimes added as a co-solvent. Containers are kept sealed and desiccated between uses. Records of lot number, reconstitution date and storage conditions support later comparison of results across experiments.
Binding of the peptide to the growth hormone-releasing hormone receptor on pituitary somatotrophs triggers a G protein coupled cascade that raises cyclic AMP and opens calcium channels. The result is greater secretion of growth hormone into the bloodstream. Because the peptide acts at the same receptor as the natural hypothalamic hormone, its effect is amplified pulse size rather than an entirely separate release pathway. Receptor binding alone does not determine the response, since somatostatin tone and other inputs modulate the final output.
The albumin-binding version stays in circulation for days, because covalent attachment to serum albumin shields the peptide from rapid filtration and degradation. Reported half-lives for this form fall in the range of several days. The version without the linker is cleared in minutes, with estimates often near thirty minutes in animal work. These figures come from small studies and vary with assay method, species, and route, so they are best read as approximate rather than fixed constants.
== External links == Dagli AI, Mathews J, Williams CA (May 2025). "Angelman Syndrome". In Adam MP, Bick S, Mirzaa GM, et al. (eds.). GeneReviews® [Internet]. University of Washington, Seattle. PMID 20301323. NBK1144. OMIM entries on Angelman syndrome UniProt entry for ubiquitin "7.340 Ubiquitination: The Proteasome and Human Disease". MIT OpenCourseWare. 2004. Notes from MIT course. Ubiquitin at the U.S. National Library of Medicine Medical Subject Headings (MeSH)
These occur at asparagine (Asn) amino acid numbers 96, 135, 155, and 192 in humans and at similar amino acid numbers in other species. All these sites are occupied by covalently attached oligosaccharide side-chains in the predominant form of human antithrombin, α-antithrombin, resulting in a molecular weight for this form of antithrombin of 58,200. The potential glycosylation site at asparagine 135 is not occupied in a minor form (around 10%) of antithrombin, β-antithrombin (see Figure 1). Recombinant antithrombins with properties similar to those of normal human antithrombin have been produced using baculovirus-infected insect cells and mammalian cell lines grown in cell culture. These recombinant antithrombins generally have different glycosylation patterns to normal antithrombin and are typically used in antithrombin structural studies. For this reason many of the antithrombin structures stored in the protein data bank and presented in this article show variable glycosylation patterns. Antithrombin begins in its native state, which has a higher free energy compared to the latent state, which it decays to on average after 3 days. The latent state has the same form as the activated state – that is, when it is inhibiting thrombin.
On 27 April 1791, Robespierre opposed plans to reorganize the National Guard and restrict its membership to active citizens, largely property owners. He demanded the reconstitution of the army on a democratic basis to allow passive citizens. He felt that the army had to become the instrument of defence of the Revolution and no longer be a threat to it. On 28 April, despite Robespierre's intensive campaign, the principle of an armed bourgeois militia was definitively enacted in the Assembly. Along with other Jacobins, he urged in his magazine the creation of a revolutionary army in Paris, consisting of 20,000 men, with the goal to defend "liberty" (the revolution), maintain order in the sections, and educate the members in democratic principles; an idea he borrowed from Jean-Jacques Rousseau and Machiavelli. According to Jean Jaures, he considered this even more important than the right to strike. Following the king's veto of the Assembly's efforts to raise a militia of volunteers, the reinstatement of Brissotin ministers and suppression of non-juring priests, the monarchy faced an abortive Demonstration of 20 June 1792. Sergent-Marceau and Panis, the administrators of police, urged the sans-culottes to lay down their weapons, telling them it was illegal to present a petition in arms, although their march to the Tuileries was not banned. They invited the officials to join the procession and march along with them.
=== Pepper spray and pests === Capsaicinoids are also an active ingredient in riot control and personal defense pepper spray agents. When the spray comes in contact with skin, especially eyes or mucous membranes, it produces pain and breathing difficulty in the affected individual. Capsaicin is also used to deter pests, specifically mammalian pests. Targets of capsaicin repellants include voles, deer, rabbits, squirrels, bears, insects, and attacking dogs. Ground or crushed dried chili pods may be used in birdseed to deter rodents, taking advantage of the insensitivity of birds to capsaicin. The Elephant Pepper Development Trust claims that using chili peppers as a barrier crop can be a sustainable means for rural African farmers to deter elephants from eating their crops. An article published in the Journal of Environmental Science and Health, Part B in 2006 states that "Although hot chili pepper extract is commonly used as a component of household and garden insect-repellent formulas, it is not clear that the capsaicinoid elements of the extract are responsible for its repellency." The first pesticide product using solely capsaicin as the active ingredient was registered with the U.S. Department of Agriculture in 1962.
Sources: en.wikipedia.org
== Environmental record == According to the 2022 "Top 100 Polluters Indexes" published by the University of Massachusetts, Amherst's "Political Economy Research Institute" (PERI), BASF was ranked the #2 largest polluter of air and #14 largest polluter of water in 2020, the most recent year for which data is available from the U.S. Environmental Protection Agency. In 2006, BASF was included in the Climate Leadership Index for their efforts in relation to climate change and greenhouse gas emissions. The BASF Company and Columbia University formed a partnership to further research "environmentally benign and sustainable energy sources". The company has recently reported their emissions in 2006 to be "1.50 million metric tons of waste," which is a decrease from previous years. The amount of waste BASF produces has continued to fall. While BASF publishes its environmental information in the US and Europe, Greenpeace has expressed deep concerns at BASF's refusal to release environmental information on its operations in China. In May 2009, a BASF Plant in Hannibal, Missouri, United States, accidentally discharged chromium into the Mississippi River. The local Department of Natural Resources performed tests in December 2009 showing the chromium levels did not exceed regulatory safety limits. BASF worked with the Missouri Department of Natural Resources (MoDNR) to resolve questions regarding the elevated level of hexavalent chromium that was detected in the effluent from one of its permitted outfalls into the Mississippi River.
Many animals can learn behaviours by imitation, but ants may be the only group apart from mammals where interactive teaching has been observed. A knowledgeable forager of Temnothorax albipennis can lead a naïve nest-mate to newly discovered food by the process of tandem running. The follower obtains knowledge through its leading tutor. The leader is acutely sensitive to the progress of the follower and slows down when the follower lags and speeds up when the follower gets too close. Controlled experiments with colonies of Cerapachys biroi suggest that an individual may choose nest roles based on her previous experience. An entire generation of identical workers was divided into two groups whose outcome in food foraging was controlled. One group was continually rewarded with prey, while it was made certain that the other failed. As a result, members of the successful group intensified their foraging attempts while the unsuccessful group ventured out fewer and fewer times. A month later, the successful foragers continued in their role while the others had moved to specialise in brood care.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Adult blaschkitis Aquadynia Aquagenic pruritus Biliary pruritus Cholestatic pruritus Drug-induced pruritus Hydroxyethyl starch-induced pruritus Lichen simplex chronicus (neurodermatitis) Prion pruritus Prurigo nodularis Prurigo pigmentosa Prurigo simplex Pruritus ani Pruritus scroti Pruritus vulvae Puncta pruritica (itchy points) Scalp pruritus Senile pruritus Uremic pruritus (renal pruritus)
MDMA is an entactogen or empathogen, as well as a stimulant, euphoriant, and weak psychedelic. It is a substrate of the monoamine transporters (MATs) and acts as a monoamine releasing agent (MRA). The drug is specifically a well-balanced serotonin–norepinephrine–dopamine releasing agent (SNDRA). To a lesser extent, MDMA also acts as a serotonin–norepinephrine–dopamine reuptake inhibitor (SNDRI). MDMA enters monoaminergic neurons via the MATs and then, via poorly understood mechanisms, reverses the direction of these transporters to produce efflux of the monoamine neurotransmitters rather than the usual reuptake. Induction of monoamine efflux by amphetamines in general may involve intracellular Na+ and Ca2+ elevation and PKC and CaMKIIα activation. MDMA also acts on the vesicular monoamine transporter 2 (VMAT2) on synaptic vesicles to increase the cytosolic concentrations of the monoamine neurotransmitters available for efflux. By inducing release and reuptake inhibition of serotonin, norepinephrine, and dopamine, MDMA increases levels of these neurotransmitters in the brain and periphery and thereby indirectly activates the receptors of these neurotransmitters. There are species differences in the balance of MAT activities of MDMA, with it showing greater influence on serotonin in rodents than in humans. In addition to its actions as an SNDRA, MDMA directly interacts with a number of monoamine and other receptors.
Sources: en.wikipedia.org
=== Everyone, Wherever You Are, Come One Step Closer (2022) === In 2022, Kermani published his most successful religion-related book to date, with the programmatic title: Everyone, Wherever You Are, Come One Step Closer. It is written as an address to Kermani's daughter. Responding to her questions about God and religion, the book offers an excellent introduction to faith for young people. While Kermani mainly focuses on Islam and explains many of the specifics of this religion, his mystical approach to religion offers a great deal of relatable content for people of all faiths. The book's detailed analysis of modern physics as a form of contemporary adaptation of traditional beliefs is striking, and the book succeeds in offering a complex and thoroughly thought-out understanding of religion in a humorous and accessible style.
is the radius of curvature of the menisci at the elongated ends of the droplet. This process is simple and consistently results in two droplets of equal volume. The conventional method of splitting an existing droplet by simply turning the splitting electrodes on and off produces new droplets of relatively equal volume. However, the new droplets formed by the conventional method show considerable difference in volume. This difference is caused by local perturbations due to the rapid mass transport. Even though the difference is negligible in some applications, it can still pose a problem in applications that are highly sensitive to variations in volume, such as immunoassays and DNA amplification. To overcome the limitation of the conventional method, an existing droplet can be split by gradually changing the potential of the electrodes at the splitting region instead of simply switching them on and off. Using this method, a noticeable improvement in droplet volume variation, from around 10% variation in volume to less than 1% variation in volume, has been reported.
Dispensing practice Cautionary Advisory Labels (CALs) information and recommendations Good compounding practice Compounding sterile and hazardous medicines Extemporaneous formulary Cold chain management Clinical drug monographs Information on complementary medicines Counseling guides for common ailments National pharmacy standards and guidelines, and Physicochemical data of drug constituents.
=== Philanthropy === In 1998, DiCaprio and his mother donated $35,000 for a "Leonardo DiCaprio Computer Center" at a library in Los Feliz. In May 2009, DiCaprio joined Kate Winslet, director James Cameron and Canadian singer Celine Dion, in a campaign to raise money to financially support the fees of the nursing home where Millvina Dean, a survivor of the RMS Titanic, was residing. DiCaprio and Winslet donated $20,000 to support Dean. In 2010, he donated $1 million to relief efforts in Haiti after the earthquake. In 2011, DiCaprio joined the Animal Legal Defense Fund's campaign to release Tony, a tiger that had spent the last decade at a truck stop in Grosse Tête, Louisiana. DiCaprio donated $61,000 to the gay rights group GLAAD in 2013. In 2016, DiCaprio donated $65,000 to the annual fundraising gala for the Children of Armenia Fund, where he was a special guest of his friend and honorary chair, Tony Shafrazi. Supporting Hurricane Harvey (2017) relief efforts, DiCaprio provided $1 million through his foundation. In 2020, DiCaprio's foundation donated $3 million to Australia bushfire relief efforts. Amidst the 2022 Russian invasion of Ukraine, the media announced DiCaprio donated $10 million to support Ukraine, although the news agency Associated Press suggested this amount was inaccurate.
Sources: en.wikipedia.org
It binds the growth hormone-releasing hormone receptor on pituitary somatotroph cells. Receptor activation raises cyclic AMP and promotes release of stored growth hormone granules. Because the peptide persists longer than natural releasing hormone, stimulation is prolonged rather than brief.
The drug affinity complex links the peptide to serum albumin through a covalent bond. The conjugate is too large to be filtered quickly by the kidneys and is shielded from enzymatic breakdown. This extends the apparent half-life from roughly minutes to several days.
Long-term safety and any clinical benefit are unestablished. Published human data cover small groups over limited periods and focus on hormone levels rather than health outcomes. Whether prolonged elevation of growth hormone and insulin-like growth factor 1 is beneficial or harmful is an open question.
The version carrying the affinity complex bears a maleimide group that binds serum albumin, which extends its circulation time to several days. The version without it lacks this group and clears within roughly half an hour. The two are chemically related but behave very differently once in the body.